PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 541aa    MW: 60373.1 Da    PI: 6.7373
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882278.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.74.2e-1101645401374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkf 93 
                     lv+lL++cAeav+ +d++ a+ lL++l+ +a   g+++qR+a++f+++La rla   +  +  + + + + ++  s+++  al+l +e++P +kf
  XP_015882278.1 164 LVQLLIACAEAVACRDKSHASLLLSELRSNALVFGSSFQRVASCFVQGLADRLAMVNPLGAVGFVSPAMNLMDvgSAKKEEALRLVYEICPHIKF 258
                     689***************************************************844443444455555545567999999************** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRp......egppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                     +h++aN+aIlea+ege+ vH++D++++     G QW  Llq+La+R+      ++p ++RiT+vg       ++ + +g+ L+ +A++lg+++ef
  XP_015882278.1 259 GHFVANSAILEAFEGESYVHVVDLGMTlalpLGHQWRELLQSLANRSgsggqqQPPRRIRITAVGL----CVDRFRIIGDELEAYANSLGMNLEF 349
                     *************************983333599*************8776644466*********....************************* PP

            GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                     +v v+++le+l++++++  +gE+l+Vn++lqlh +++es    +   +vL++v +lsPkv+v+veq+++hn++ Fl rf+eal+yysa+fdsl+a
  XP_015882278.1 350 SV-VESNLENLQPKDIKRFEGEVLVVNSILQLHCVVKESRGALN---SVLQMVHELSPKVLVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDA 440
                     *9.7********************************88877777...8*********************************************** PP

            GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                      lp+ +  r+k+E++++++ei+n+++ceg +r+erhe++ +Wr+r+++aGF+  p++    ++ak  l+++k  +g+++ ee+g+lvlgWk++p+
  XP_015882278.1 441 MLPKYDTRRAKIEQFYFAEEIKNIISCEGPARVERHERVDQWRRRMSRAGFQGSPIKM--IAEAKQWLENIKaCEGFTIVEEKGCLVLGWKSKPI 533
                     *******************************************************986..55799999999999********************* PP

            GRAS 368 vsvSaWr 374
                     +++S+W+
  XP_015882278.1 534 IAASCWK 540
                     ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.693138521IPR005202Transcription factor GRAS
PfamPF035141.4E-107164540IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MAPRHNMLSK IQFFEQGMAE SLSNLDLSLS AMAYYPYPYM PILEENDSTM ILPFCDEIQN  60
HKRHKRVMSM AESISSNSNS SFYSRGSSGG SNGSSNMSIS SCNMCRSNST SSLNSLPRLQ  120
FRDHIWTYTQ RYLAAEAVEE AAAAMINREE SGTEDRGGTD GMRLVQLLIA CAEAVACRDK  180
SHASLLLSEL RSNALVFGSS FQRVASCFVQ GLADRLAMVN PLGAVGFVSP AMNLMDVGSA  240
KKEEALRLVY EICPHIKFGH FVANSAILEA FEGESYVHVV DLGMTLALPL GHQWRELLQS  300
LANRSGSGGQ QQPPRRIRIT AVGLCVDRFR IIGDELEAYA NSLGMNLEFS VVESNLENLQ  360
PKDIKRFEGE VLVVNSILQL HCVVKESRGA LNSVLQMVHE LSPKVLVLVE QDSSHNGPFF  420
LGRFMEALHY YSAIFDSLDA MLPKYDTRRA KIEQFYFAEE IKNIISCEGP ARVERHERVD  480
QWRRRMSRAG FQGSPIKMIA EAKQWLENIK ACEGFTIVEE KGCLVLGWKS KPIIAASCWK  540
C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-441645404375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882278.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLB9IF610.0B9IF61_POPTR; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-72GRAS family protein